PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_53086.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 336aa    MW: 39042.7 Da    PI: 6.7425
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_53086.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.76.3e-5591391129
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                   +ppGfrFhPtdeelv++yL+kkv++++++l +vik+vd+yk+ePwdL++      ++e+++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++
  MLOC_53086.2   9 VPPGFRFHPTDEELVDYYLRKKVASRRIDL-NVIKDVDLYKIEPWDLQEkcriGPEEEQSDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKPIY 104
                   69****************************.99**************95343322335669************************************ PP

           NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                   + k+ lvg++ktLv+ykgrap+g+k+dW+mheyrle
  MLOC_53086.2 105 A-KHCLVGMRKTLVYYKGRAPNGQKSDWIMHEYRLE 139
                   *.899*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.02E-616159IPR003441NAC domain
PROSITE profilePS5100559.1899159IPR003441NAC domain
PfamPF023651.3E-2810138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MSGSTQPQVP PGFRFHPTDE ELVDYYLRKK VASRRIDLNV IKDVDLYKIE PWDLQEKCRI  60
GPEEEQSDWY FFSHKDKKYP TGTRTNRATA AGFWKATGRD KPIYAKHCLV GMRKTLVYYK  120
GRAPNGQKSD WIMHEYRLET NENGPPQEEG WVVCRVFKKR LPTTRRDLDH DAPCWYVDDD  180
GPFMHDLNSP MRGMPPHHSM ALQEQHLQML NNTYKRELKL QYQMPNHHHV LNTIPHELES  240
PSSFHSLLVS QDDHQINVHH AQHHHVQLID HAVDDQAATD WRVLDKFVAS QLSNDAAKGV  300
DYAHEGDILQ LNEKVQEVAT DYASTSTSSS QVDPWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-50516013166NO APICAL MERISTEM PROTEIN
1ut4_B1e-50516013166NO APICAL MERISTEM PROTEIN
1ut7_A1e-50516013166NO APICAL MERISTEM PROTEIN
1ut7_B1e-50516013166NO APICAL MERISTEM PROTEIN
4dul_A1e-50516013166NAC domain-containing protein 19
4dul_B1e-50516013166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304791.10.0NAC domain-containing protein 7-like
RefseqXP_014754958.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX21e-116NAC7_ARATH; NAC domain-containing protein 7
TrEMBLM0WN190.0M0WN19_HORVD; Uncharacterized protein
STRINGMLOC_53086.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP121023039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-101NAC 007